Structure of PDB 5hod Chain A Binding Site BS01

Receptor Information
>5hod Chain A (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWF
QNRRAKEKRLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hod Impact of cytosine methylation on DNA binding specificities of human transcription factors.
Resolution2.682 Å
Binding residue
(original residue number in PDB)		R87 R89 I92 V131 N135
Binding residue
(residue number reindexed from 1)		R4 R6 I9 V48 N52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5hod, PDBe:5hod, PDBj:5hod
PDBsum5hod
PubMed28473536
UniProtQ969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 (Gene Name=LHX4)

[Back to BioLiP]