Structure of PDB 5ho4 Chain A Binding Site BS01

Receptor Information
>5ho4 Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGF
GFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKL
FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHD
PVDKIVLQKYHTINGHNAEVRKALSRQEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ho4 Molecular basis for the specific and multivariant recognitions of RNA substrates by human hnRNP A2/B1.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Q19 K22 F24 G26 G27 D49 V51 M53 R62 G63 F64 F66 E92 A96 V97 R99
Binding residue
(residue number reindexed from 1)		Q5 K8 F10 G12 G13 D35 V37 M39 R48 G49 F50 F52 E78 A82 V83 R85
Binding affinityPDBbind-CN: Kd=114.7nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5ho4, PDBe:5ho4, PDBj:5ho4
PDBsum5ho4
PubMed29379020
UniProtP22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]