Structure of PDB 5hnk Chain A Binding Site BS01

Receptor Information

>5hnk Chain A (length=272) Species: 10726 (Tequintavirus T5)

RNLMIVDGTNLGFRFKHNNSKKPFASSYVSTIQSLAKSYSARTTIVLGDK
GKSVFRLEHLPEYKGNRDEKYAQRTEEEKALDEQFFEYLKDAFELCKTTF
PTFTIRGVEADDMAAYIVKLIGHLYDHVWLISTKGDWDTLLTDKVSRFSF
TTRREYHLRDMYEHHNVDDVEQFISLKAIMGDLGDNIRGVEGIGAKRGYN
IIREFGNVLDIIDQLPLPGKQKYIQNLNASEELLFRNLILVDLPTYCVDA
IAAVGQDVLDKFTKDILEIAEQ

Ligand information

>5hnk Chain X (length=12)

aaaagcgtacgc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5hnk Direct observation of DNA threading in flap endonuclease complexes.
• Resolution: 2.22 Å
• Binding residue (original residue number in PDB): F32 H36 R86 T152 K153 G154 T170
• Binding residue (residue number reindexed from 1): F13 H17 R67 T133 K134 G135 T151

Enzymatic activity

• Enzyme Commision number: 3.1.11.-
  3.1.11.3: exodeoxyribonuclease (lambda-induced).

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0004519 endonuclease activity
• GO:0004527 exonuclease activity
• GO:0004529 DNA exonuclease activity
• GO:0008409 5'-3' exonuclease activity
• GO:0016788 hydrolase activity, acting on ester bonds
• GO:0017108 5'-flap endonuclease activity
• GO:0035312 5'-3' DNA exonuclease activity
• GO:0046872 metal ion binding
• GO:0048256 flap endonuclease activity
• GO:0051908 double-stranded DNA 5'-3' DNA exonuclease activity
• GO:1990238 double-stranded DNA endonuclease activity

Biological Process

• GO:0006260 DNA replication
• GO:0019086 late viral transcription
• GO:0033567 DNA replication, Okazaki fragment processing
• GO:0039693 viral DNA genome replication

Cellular Component

• GO:0019034 viral replication complex

External links

• PDB: RCSB:5hnk, PDBe:5hnk, PDBj:5hnk
• PDBsum: 5hnk
• PubMed: 27273516
• UniProt: P06229|FEN_BPT5 Flap endonuclease (Gene Name=D15)