Structure of PDB 5hnh Chain A Binding Site BS01

Receptor Information
>5hnh Chain A (length=279) Species: 1408 (Bacillus pumilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYNPEEQFRCTIIRGKAKNMLDNLLPAYANIIDDICPCDKASFVKDFNNR
LIEILGEETTKKTLDNHRTEIAGKLFGMFYEDDEVIFPSGRTNKYIEDSD
QPAFFKDICFKFQFPNGMDKLDKVIEKVGAKIQIRQFPYILQVLLTADNN
NIQLSKDDIAYYVLNSLQVLQGKIKPIEVIEKIIEDRSNDITKKVRHPGK
ETSYSMQHIREQLNYLELANLIRIDGNLVKLNYREAENINYIAQFWGNKP
EFNAYKYDFTSEDDKKSFFKDWQQYYSNV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hnh Structural insight into DNA-assembled oligochromophores: crystallographic analysis of pyrene- and phenanthrene-modified DNA in complex with BpuJI endonuclease.
Resolution1.876 Å
Binding residue
(original residue number in PDB)		R15 K62 K63 N67 T70 E71 K75 M119 D120 K121 K124 K201 E202 S204 Y205
Binding residue
(residue number reindexed from 1)		R14 K61 K62 N66 T69 E70 K74 M118 D119 K120 K123 K200 E201 S203 Y204
Enzymatic activity
Enzyme Commision number ?
External links