Structure of PDB 5hkz Chain A Binding Site BS01

Receptor Information

>5hkz Chain A (length=303) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRT
ILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQP
RRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEK
TIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRL
FQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSC
TRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNP
DLT

Ligand information

>5hkz Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QQVHVLSLDQIRAIRNTNEYTEGP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5hkz Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (36-60, pY55) Refined to 1.8 A Resolution (P21 form)
Resolution	1.8 Å
Binding residue (original residue number in PDB)	D64 R68 Q71 N79 P81 D86 P89 Y92 Y274 R294 S296 C297 T298 Y307 Q316 T317 I318 F336
Binding residue (residue number reindexed from 1)	D17 R21 Q24 N32 P34 D39 P42 Y45 Y227 R247 S249 C250 T251 Y260 Q269 T270 I271 F289

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0001784	phosphotyrosine residue binding
GO:0004842	ubiquitin-protein transferase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0007166	cell surface receptor signaling pathway
GO:0023051	regulation of signaling

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5hkz, PDBe:5hkz, PDBj:5hkz
PDBsum	5hkz
PubMed
UniProt	P22681\|CBL_HUMAN E3 ubiquitin-protein ligase CBL (Gene Name=CBL)

[Back to BioLiP]