Structure of PDB 5hkh Chain A Binding Site BS01

Receptor Information
>5hkh Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMESKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATS
AIITNDGIGINPAQTAGNVFLKHGSELRIIPRDRVG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hkh Structural and Functional Analysis of a Novel Interaction Motif within UFM1-activating Enzyme 5 (UBA5) Required for Binding to Ubiquitin-like Proteins and Ufmylation.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		K3 V20 L21 S22 P24 P28 A31 V32 F35
Binding residue
(residue number reindexed from 1)		K6 V23 L24 S25 P27 P31 A34 V35 F38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007420 brain development
GO:0033146 regulation of intracellular estrogen receptor signaling pathway
GO:0034976 response to endoplasmic reticulum stress
GO:0042308 negative regulation of protein import into nucleus
GO:0043066 negative regulation of apoptotic process
GO:0061709 reticulophagy
GO:0071569 protein ufmylation
GO:1990592 protein K69-linked ufmylation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hkh, PDBe:5hkh, PDBj:5hkh
PDBsum5hkh
PubMed26929408
UniProtP61960|UFM1_HUMAN Ubiquitin-fold modifier 1 (Gene Name=UFM1)

[Back to BioLiP]