Structure of PDB 5hkc Chain A Binding Site BS01

Receptor Information
>5hkc Chain A (length=114) Species: 83331 (Mycobacterium tuberculosis CDC1551) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITS
NDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASL
MHEVDRGLRRVLDL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hkc Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with 8-mer RNA
Resolution1.68 Å
Binding residue
(original residue number in PDB)		W10 R24 P26 I48 T49 S50 P71 R72 S74
Binding residue
(residue number reindexed from 1)		W10 R24 P26 I48 T49 S50 P71 R72 S74
Enzymatic activity
Enzyme Commision number 3.1.27.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
Biological Process
GO:0006402 mRNA catabolic process
GO:0016075 rRNA catabolic process
GO:0044003 symbiont-mediated perturbation of host process
GO:0045926 negative regulation of growth
GO:0045927 positive regulation of growth
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hkc, PDBe:5hkc, PDBj:5hkc
PDBsum5hkc
PubMed
UniProtP9WII3|MAZF6_MYCTU Endoribonuclease MazF6 (Gene Name=mazF6)

[Back to BioLiP]