Structure of PDB 5hjc Chain A Binding Site BS01

Receptor Information
>5hjc Chain A (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPM
DLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQD
VFEMRFAKMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hjc Molecular Coupling of Histone Crotonylation and Active Transcription by AF9 YEATS Domain
Resolution2.6 Å
Binding residue
(original residue number in PDB)
V338 L345 D347 N391 P392 D394 H395
Binding residue
(residue number reindexed from 1)
V32 L39 D41 N85 P86 D88 H89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5hjc, PDBe:5hjc, PDBj:5hjc
PDBsum5hjc
PubMed27105114
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]