Structure of PDB 5hjb Chain A Binding Site BS01

Receptor Information
>5hjb Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFV
EKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKV
RFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hjb Molecular Coupling of Histone Crotonylation and Active Transcription by AF9 YEATS Domain
Resolution2.7 Å
Binding residue
(original residue number in PDB)		F28 H56 S58 F59 G77 Y78 A79 G80 D103 F105 L106 H107 H111
Binding residue
(residue number reindexed from 1)		F30 H58 S60 F61 G79 Y80 A81 G82 D105 F107 L108 H109 H113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5hjb, PDBe:5hjb, PDBj:5hjb
PDBsum5hjb
PubMed27105114
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]