Structure of PDB 5hff Chain A Binding Site BS01

Receptor Information
>5hff Chain A (length=118) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPA
DLSGELRKGDQILSVNGVDLRNASAEQAAIALKNAGQTVTIIAQYKPEEY
SRFEANSRVDSSGRIVTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hff Origins of Allostery and Evolvability in Proteins: A Case Study.
Resolution1.749 Å
Binding residue
(original residue number in PDB)
G322 L323 G324 F325 N326 I327 V328 G329 T330 E331 S339 A372 E373
Binding residue
(residue number reindexed from 1)
G25 L26 G27 F28 N29 I30 V31 G32 T33 E34 S42 A75 E76
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5hff, PDBe:5hff, PDBj:5hff
PDBsum5hff
PubMed27321669
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]