Structure of PDB 5hfb Chain A Binding Site BS01

Receptor Information
>5hfb Chain A (length=117) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPAD
LSGELRKGDQILSVNGVDLRNASAEQAAIALKNAGQTVTIIAQYKPEEYS
RFEANSRVDSSGRIVTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hfb Origins of Allostery and Evolvability in Proteins: A Case Study.
Resolution1.616 Å
Binding residue
(original residue number in PDB)
G322 L323 G324 F325 N326 I327 V328 E331 S339
Binding residue
(residue number reindexed from 1)
G24 L25 G26 F27 N28 I29 V30 E33 S41
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5hfb, PDBe:5hfb, PDBj:5hfb
PDBsum5hfb
PubMed27321669
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]