Structure of PDB 5hda Chain A Binding Site BS01

Receptor Information
>5hda Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQ
VKEKCKEEFVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSY
CSIKCQQEHWHAEHKRTCRRK
Ligand information
>5hda Chain B (length=8) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SMPELSPV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hda BS69/ZMYND11 C-Terminal Domains Bind and Inhibit EBNA2.
Resolution2.3899 Å
Binding residue
(original residue number in PDB)		M531 Y532 H533 C534 Q546 Q547 W550 R560
Binding residue
(residue number reindexed from 1)		M91 Y92 H93 C94 Q106 Q107 W110 R120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
Biological Process
GO:0034243 regulation of transcription elongation by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5hda, PDBe:5hda, PDBj:5hda
PDBsum5hda
PubMed26845565
UniProtQ15326|ZMY11_HUMAN Zinc finger MYND domain-containing protein 11 (Gene Name=ZMYND11)

[Back to BioLiP]