Structure of PDB 5hbu Chain A Binding Site BS01

Receptor Information

>5hbu Chain A (length=190) Species: 83333 (Escherichia coli K-12)

RNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRM
FDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRI
LTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKRMREGEGYTTDETLL
ASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ

Ligand information

>5hbu Chain W (length=12)

gtgagtactcac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5hbu Structures of the nucleoid occlusion protein SlmA bound to DNA and the C-terminal domain of the cytoskeletal protein FtsZ.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): V43 S44 A46 A47 R50
• Binding residue (residue number reindexed from 1): V35 S36 A38 A39 R42

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0000918 division septum site selection
• GO:0006355 regulation of DNA-templated transcription
• GO:0010974 negative regulation of division septum assembly
• GO:0032272 negative regulation of protein polymerization
• GO:0051301 cell division
• GO:0051302 regulation of cell division

Cellular Component

• GO:0005737 cytoplasm
• GO:0009295 nucleoid
• GO:0043590 bacterial nucleoid

External links

• PDB: RCSB:5hbu, PDBe:5hbu, PDBj:5hbu
• PDBsum: 5hbu
• PubMed: 27091999
• UniProt: P0C093|SLMA_ECOLI Nucleoid occlusion factor SlmA (Gene Name=slmA)