Structure of PDB 5h9b Chain A Binding Site BS01

Receptor Information

>5h9b Chain A (length=269) Species: 7227 (Drosophila melanogaster)

CTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQ
KLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVARE
FYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLA
DFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI
LLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVN
PNKRITAAEALKHPWICQR

Ligand information

>5h9b Chain B (length=17) Species: 7227 (Drosophila melanogaster)

QATLARQDTIDEGGEVD

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5h9b The Interaction between the Drosophila EAG Potassium Channel and the Protein Kinase CaMKII Involves an Extensive Interface at the Active Site of the Kinase.
• Resolution: 2.25 Å
• Binding residue (original residue number in PDB): R53 K57 E97 F99 D136 K138 E140 L160 W171 F172 G173 F174 A175 G176 T177 P178 G179 W215
• Binding residue (residue number reindexed from 1): R47 K51 E91 F93 D130 K132 E134 L154 W165 F166 G167 F168 A169 G170 T171 P172 G173 W209

Enzymatic activity

• Catalytic site (original residue number in PDB): D136 K138 N141 D157 T177
• Catalytic site (residue number reindexed from 1): D130 K132 N135 D151 T171
• Enzyme Commision number: 2.7.11.17: calcium/calmodulin-dependent protein kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:5h9b, PDBe:5h9b, PDBj:5h9b
• PDBsum: 5h9b
• PubMed: 30381148
• UniProt: Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain (Gene Name=CaMKII)