Structure of PDB 5h94 Chain A Binding Site BS01

Receptor Information
>5h94 Chain A (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPREEPRAP
WIQQEGQEYWDRETQISKDNAQTYRVNLNNLRGYYNQSEAGSHTFQNMYG
CYLGPDGLLLHGYHQYAYDGADYIALNEDLRSWTAADTAAQITKRKWEAS
GWAEQERSYLQGLCVESLREYLEMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
>5h94 Chain C (length=9) Species: 36420 (H1N1 swine influenza virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KMNTQFTAV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5h94 Structural and Biochemical Analyses of Swine Major Histocompatibility Complex Class I Complexes and Prediction of the Epitope Map of Important Influenza A Virus Strains
Resolution1.48 Å
Binding residue
(original residue number in PDB)		Y8 Y10 E46 Y60 R63 E64 I67 D70 T74 Y75 N78 N81 Y85 F96 Y100 H115 T144 W148 S151 W153 E157 Y160 S168 Y172
Binding residue
(residue number reindexed from 1)		Y7 Y9 E45 Y59 R62 E63 I66 D69 T73 Y74 N77 N80 Y84 F95 Y99 H114 T143 W147 S150 W152 E156 Y159 S167 Y171
Enzymatic activity
Enzyme Commision number ?
External links