Structure of PDB 5h58 Chain A Binding Site BS01

Receptor Information

>5h58 Chain A (length=194) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LRAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKE
DLAHAILEIQSRTSRRLAKDLDGRGYSSLEALMRLTFGMARLCVQGPVLR
AGLRLATAPVRPPLPHPFTEWREIATSRLLDAVRQSDVHQDIDVDSVAHT
LVCSVVGTREPRRLAEMWYILIRGMVPVTRRARYVTLAARLEQE

Ligand information

>5h58 Chain E (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aggcggcacggtctgttgag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5h58 Structural and dynamics studies of the TetR family protein, CprB from Streptomyces coelicolor in complex with its biological operator sequence
Resolution	3.991 Å
Binding residue (original residue number in PDB)	T42 A45 F48
Binding residue (residue number reindexed from 1)	T38 A41 F44

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5h58, PDBe:5h58, PDBj:5h58
PDBsum	5h58
PubMed	28343010
UniProt	Q7AKF2

[Back to BioLiP]