Structure of PDB 5h3r Chain A Binding Site BS01

Receptor Information
>5h3r Chain A (length=141) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAA
CITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTG
GAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLKKVLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5h3r Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.
Resolution2.67 Å
Binding residue
(original residue number in PDB)		T39 Q42 D67 A70 R73 M74 R77 K93 R94
Binding residue
(residue number reindexed from 1)		T36 Q39 D64 A67 R70 M71 R74 K90 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0009408 response to heat
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:0071236 cellular response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5h3r, PDBe:5h3r, PDBj:5h3r
PDBsum5h3r
PubMed28124121
UniProtP27245|MARR_ECOLI Multiple antibiotic resistance protein MarR (Gene Name=marR)

[Back to BioLiP]