Structure of PDB 5h3j Chain A Binding Site BS01

Receptor Information
>5h3j Chain A (length=197) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKD
LLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDG
ANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHE
AKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPT
Ligand information
>5h3j Chain B (length=21) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRYENITFNCCNHCQGELIAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5h3j Structural Basis for the Interaction between Golgi Reassembly-stacking Protein GRASP55 and Golgin45
Resolution1.33 Å
Binding residue
(original residue number in PDB)		H18 L20 R21 Q23 E24 F36 L95 L96 G97 V98 S99 I100 R101 F102 C103 N144 Y164 C173 R174 E175
Binding residue
(residue number reindexed from 1)		H11 L13 R14 Q16 E17 F29 L88 L89 G90 V91 S92 I93 R94 F95 C96 N137 Y157 C166 R167 E168
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5h3j, PDBe:5h3j, PDBj:5h3j
PDBsum5h3j
PubMed28049725
UniProtQ99JX3|GORS2_MOUSE Golgi reassembly-stacking protein 2 (Gene Name=Gorasp2)

[Back to BioLiP]