Structure of PDB 5h10 Chain A Binding Site BS01

Receptor Information

>5h10 Chain A (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKI
TNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLS
LFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQR
PQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETS

Ligand information

>5h10 Chain D (length=6) Species: 160651 (Peptide display vector fth1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VPIQCT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5h10 TRAF1-TANk complex
Resolution	3.205 Å
Binding residue (original residue number in PDB)	Y310 D314 F325 F362 R363 A381 G383 P385
Binding residue (residue number reindexed from 1)	Y87 D91 F102 F139 R140 A158 G160 P162

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005164	tumor necrosis factor receptor binding

	Biological Process
GO:0042981	regulation of apoptotic process

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5h10, PDBe:5h10, PDBj:5h10
PDBsum	5h10
PubMed
UniProt	Q13077\|TRAF1_HUMAN TNF receptor-associated factor 1 (Gene Name=TRAF1)

[Back to BioLiP]