Structure of PDB 5gxq Chain A Binding Site BS01

Receptor Information
>5gxq Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLVRKLPFQRLVREIAQDFKTDLRFQSA
AIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAHSIRGER
Ligand information
>5gxq Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gxq Crystal Structure and Characterization of Novel Human Histone H3 Variants, H3.6, H3.7, and H3.8
Resolution2.85 Å
Binding residue
(original residue number in PDB)		R42 P43 T45 R63 R72 R83 F84 Q85 R116 V117 T118
Binding residue
(residue number reindexed from 1)		R5 P6 T8 R26 R35 R46 F47 Q48 R79 V80 T81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5gxq, PDBe:5gxq, PDBj:5gxq
PDBsum5gxq
PubMed28374988
UniProtA0A1X8XL64

[Back to BioLiP]