Structure of PDB 5gtu Chain A Binding Site BS01

Receptor Information
>5gtu Chain A (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESY
DYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDM
ASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNALETNI
IPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP
Ligand information
>5gtu Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QDLMINNPLSQDEGSLWNKFFQDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gtu Structural and mechanistic insights into regulation of the retromer coat by TBC1d5
Resolution1.5 Å
Binding residue
(original residue number in PDB)		M-3 L2 K30 L152 Y163 Y165 V172 V174 R176
Binding residue
(residue number reindexed from 1)		M1 L6 K34 L156 Y167 Y169 V176 V178 R180
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006886 intracellular protein transport
GO:0010506 regulation of autophagy
GO:0015031 protein transport
GO:0032456 endocytic recycling
GO:0042147 retrograde transport, endosome to Golgi
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005829 cytosol
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030904 retromer complex
GO:0030906 retromer, cargo-selective complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gtu, PDBe:5gtu, PDBj:5gtu
PDBsum5gtu
PubMed27827364
UniProtQ9UBQ0|VPS29_HUMAN Vacuolar protein sorting-associated protein 29 (Gene Name=VPS29)

[Back to BioLiP]