Structure of PDB 5gsv Chain A Binding Site BS01

Receptor Information
>5gsv Chain A (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAP
WMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFG
CDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQA
GDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVT
LRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVP
LGKEQNYTCHVHHKGLPEPLTLRW
Ligand information
>5gsv Chain C (length=10) Species: 1335626 (Middle East respiratory syndrome-related coronavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FYAPEPITSL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gsv Protective T Cell Responses Featured by Concordant Recognition of Middle East Respiratory Syndrome Coronavirus-Derived CD8+ T Cell Epitopes and Host MHC.
Resolution1.996 Å
Binding residue
(original residue number in PDB)		Y7 F45 Y59 Q63 R66 S69 D70 W73 S77 Y84 F99 Y123 T143 K146 W147 D152 Y155 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 F45 Y59 Q63 R66 S69 D70 W73 S77 Y84 F99 Y123 T143 K146 W147 D152 Y155 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5gsv, PDBe:5gsv, PDBj:5gsv
PDBsum5gsv
PubMed27903740
UniProtP01902|HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain (Gene Name=H2-K1)

[Back to BioLiP]