Structure of PDB 5gsb Chain A Binding Site BS01

Receptor Information
>5gsb Chain A (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAP
WMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFG
CDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQA
GDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVT
LRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVP
LGKEQNYTCHVHHKGLPEPLTLRW
Ligand information
>5gsb Chain C (length=9) Species: 1335626 (Middle East respiratory syndrome-related coronavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YYSIIPHSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gsb Protective T Cell Responses Featured by Concordant Recognition of Middle East Respiratory Syndrome Coronavirus-Derived CD8+ T Cell Epitopes and Host MHC.
Resolution1.801 Å
Binding residue
(original residue number in PDB)		Y7 V9 Y59 Q63 R66 D70 W73 V76 S77 T80 Y84 R97 F99 F116 T143 W147 D152 Y155 Y156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 V9 Y59 Q63 R66 D70 W73 V76 S77 T80 Y84 R97 F99 F116 T143 W147 D152 Y155 Y156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5gsb, PDBe:5gsb, PDBj:5gsb
PDBsum5gsb
PubMed27903740
UniProtP01902|HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain (Gene Name=H2-K1)

[Back to BioLiP]