Structure of PDB 5gr7 Chain A Binding Site BS01

Receptor Information
>5gr7 Chain A (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAP
WMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFG
CDVGSDWRLLRGYHQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQA
GDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVT
LRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVP
LGKEQNYTCHVHHKGLPEPLTLRW
Ligand information
>5gr7 Chain C (length=9) Species: 1335626 (Middle East respiratory syndrome-related coronavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YYSIIPHSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gr7 Protective T Cell Responses Featured by Concordant Recognition of Middle East Respiratory Syndrome Coronavirus-Derived CD8+ T Cell Epitopes and Host MHC.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
Y7 V9 F45 Y59 Q63 R66 D70 W73 F74 S77 T80 Y84 R97 F99 T143 W147 D152 Y155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 V9 F45 Y59 Q63 R66 D70 W73 F74 S77 T80 Y84 R97 F99 T143 W147 D152 Y155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5gr7, PDBe:5gr7, PDBj:5gr7
PDBsum5gr7
PubMed27903740
UniProtP01902|HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain (Gene Name=H2-K1)

[Back to BioLiP]