Structure of PDB 5gnv Chain A Binding Site BS01

Receptor Information
>5gnv Chain A (length=181) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHF
VSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSA
NAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQ
EFTECFSAIVEGDSFEEIYHKVKRVIEDLSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gnv Structure of the PSD-95/MAP1A complex reveals a unique target recognition mode of the MAGUK GK domain
Resolution2.596 Å
Binding residue
(original residue number in PDB)
D549 L552 R568 Y580 E600 Y604 Y609 T611 I627 D629
Binding residue
(residue number reindexed from 1)
D17 L20 R36 Y48 E68 Y72 Y77 T79 I95 D97
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5gnv, PDBe:5gnv, PDBj:5gnv
PDBsum5gnv
PubMed28701415
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]