Structure of PDB 5gnd Chain A Binding Site BS01

Receptor Information

>5gnd Chain A (length=280) Species: 1111708 (Synechocystis sp. PCC 6803 substr. Kazusa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFVAAAVSRSGPAVVRIDQGSGFIIDNSGIILTNAHVVDGASVVVTLRDG
RTFDGQVRGTDEVTDLAVVKIEPQGSALPVAPLGTSSNLQVGDWAIAVGN
PVGLDNTVTLGIISTLGVEFIQTDAAINPGNSGGPLLNARGEVIGINTAI
GIGFAIPIDQAKAIQNTLAAGGTVPHPYIGVQMMNITVDQAQQNNRNPNS
PFIIPEVDGILVMRVLPGTPAERAGIRRGDVIVAVDGTPISDGARLQRIV
EQAGLNKALKLDLLRGDRRLSLTVQTAQLR

Ligand information

>5gnd Chain U (length=5) Species: 469008 (Escherichia coli BL21(DE3)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GGGGW

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gnd Crystal structure of the zinc-bound HhoA protease from Synechocystis sp. PCC 6803
Resolution	2.5 Å
Binding residue (original residue number in PDB)	Y288 I289 G290 V291 M293 N295 Q357 V360
Binding residue (residue number reindexed from 1)	Y178 I179 G180 V181 M183 N185 Q247 V250

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0008233	peptidase activity
GO:0042802	identical protein binding

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0030288	outer membrane-bounded periplasmic space
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5gnd, PDBe:5gnd, PDBj:5gnd
PDBsum	5gnd
PubMed	27616292
UniProt	P72780\|HHOA_SYNY3 Putative serine protease HhoA (Gene Name=hhoA)

[Back to BioLiP]