Structure of PDB 5gmv Chain A Binding Site BS01

Receptor Information
>5gmv Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLV
PDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKD
EDGFLYMVYASQETFGMKLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gmv Structural insights into the recognition of phosphorylated FUNDC1 by LC3B in mitophagy
Resolution2.25 Å
Binding residue
(original residue number in PDB)		D19 I23 K49 K51 F52 L53 P55 I66 R70 F108
Binding residue
(residue number reindexed from 1)		D15 I19 K45 K47 F48 L49 P51 I62 R66 F104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0097001 ceramide binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0000423 mitophagy
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0009267 cellular response to starvation
GO:0016236 macroautophagy
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0031090 organelle membrane
GO:0031410 cytoplasmic vesicle
GO:0031966 mitochondrial membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gmv, PDBe:5gmv, PDBj:5gmv
PDBsum5gmv
PubMed27757847
UniProtQ9GZQ8|MLP3B_HUMAN Microtubule-associated proteins 1A/1B light chain 3B (Gene Name=MAP1LC3B)

[Back to BioLiP]