Structure of PDB 5gmj Chain A Binding Site BS01

Receptor Information

>5gmj Chain A (length=223) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

STSLYKKAGFLVPRGSGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEP
FFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVT
PSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDY
IIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWG
GEGSLGCGIGYGYLHRIPTRPFE

Ligand information

>5gmj Chain D (length=6) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TKSFII

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gmj Genetic, structural, and chemical insights into the dual function of GRASP55 in germ cell Golgi remodeling and JAM-C polarized localization during spermatogenesis
Resolution	2.986 Å
Binding residue (original residue number in PDB)	Y17 D51 Q93 G94 L95 L96 G97 V98 S99 I100 F102 D140 T141 Y164
Binding residue (residue number reindexed from 1)	Y32 D66 Q108 G109 L110 L111 G112 V113 S114 I115 F117 D155 T156 Y179

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:5gmj, PDBe:5gmj, PDBj:5gmj
PDBsum	5gmj
PubMed	28617811
UniProt	Q99JX3\|GORS2_MOUSE Golgi reassembly-stacking protein 2 (Gene Name=Gorasp2)

[Back to BioLiP]