Structure of PDB 5gmi Chain A Binding Site BS01

Receptor Information

>5gmi Chain A (length=223) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

STSLYKKAGFLVPRGSGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEP
FFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVT
PSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDY
IIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWG
GEGSLGCGIGYGYLHRIPTRPFE

Ligand information

>5gmi Chain C (length=5) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SSFVI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gmi Genetic, structural, and chemical insights into the dual function of GRASP55 in germ cell Golgi remodeling and JAM-C polarized localization during spermatogenesis
Resolution	2.71 Å
Binding residue (original residue number in PDB)	L95 L96 G97 V98 I100 R101 D140 Y164
Binding residue (residue number reindexed from 1)	L110 L111 G112 V113 I115 R116 D155 Y179

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:5gmi, PDBe:5gmi, PDBj:5gmi
PDBsum	5gmi
PubMed	28617811
UniProt	Q99JX3\|GORS2_MOUSE Golgi reassembly-stacking protein 2 (Gene Name=Gorasp2)

[Back to BioLiP]