Structure of PDB 5gkr Chain A Binding Site BS01

Receptor Information
>5gkr Chain A (length=207) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQESGPGLVKSSETLSLTCTVSGGSISSYFWSWIRQPPGKGLEWIGYI
YYSGSTNYNPSLKSRVTISLHTSKNQFSLKLSSVTAADTAVYYCARHRNW
LFDYWGQGTLVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWN
SGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVDHKPSNT
KVDKTVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gkr Clonal evolution and antigen recognition of anti-nuclear antibodies in acute systemic lupus erythematosus
Resolution2.1 Å
Binding residue
(original residue number in PDB)		F33 Y50 Y52 S54 G55 S56 N58 H95 N97 W98
Binding residue
(residue number reindexed from 1)		F32 Y49 Y51 S53 G54 S55 N57 H97 N99 W100
Binding affinityPDBbind-CN: Kd=4.61nM
External links