Structure of PDB 5gkp Chain A Binding Site BS01

Receptor Information
>5gkp Chain A (length=235) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRSAEIMKHGYPGFTNVRTYEDFVLSYDYKTRTAHWVCEHLTPERLKGVD
RKLCEAKPDITFPQKFLSQNTDYKCSGFDRGALAAAGNHRKSQLAVDQTF
YLSNMSPQVGRGFNRDKWNDLEMHCRRVAKKMINSYIITGPLYLPKLEGD
GKKYIKYQVIGDNNVAVPTHFFKVALFEVTPGKFELESYILPNAVIEDTV
EISKFHVPLDAVERSAGLEIFARLDPKSIVKENGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gkp Crystal structure of endonuclease G in complex with DNA reveals how it nonspecifically degrades DNA as a homodimer.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R117 K140 C141 D145 R146 A148 A152 R181 N185
Binding residue
(residue number reindexed from 1)		R51 K74 C75 D79 R80 A82 A86 R115 N119
Enzymatic activity
Enzyme Commision number 3.1.30.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:5gkp, PDBe:5gkp, PDBj:5gkp
PDBsum5gkp
PubMed27738134
UniProtQ95NM6|NUCG_CAEEL Endonuclease G, mitochondrial (Gene Name=cps-6)

[Back to BioLiP]