Structure of PDB 5gki Chain A Binding Site BS01

Receptor Information
>5gki Chain A (length=239) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKDKVTVITSPSTEELVSLVNSALLEEAMLTIFARCKVHYDGRAKSELGS
GDRVIIVKPDGSFLIHQSKKREPVNWQPPGSRVRLELRENPVLVSIRRKP
RETLEVELEEVYMVSVFRAEDYEELALTGSEAEMAELIFENPEVIEPGFK
PLFREKAIGTGIVAVLGRDSDGNIVVLELKRRRAELHAVRQLKSYVEILR
EEYGDKVRGILVAPSLTSGAKRLLEKEGLEFRKLEPPKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gki Structure of the EndoMS-DNA Complex as Mismatch Restriction Endonuclease
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y41 R44 A45 N76 W77 R184 L187 R191 T218 S219 G220
Binding residue
(residue number reindexed from 1)		Y40 R43 A44 N75 W76 R183 L186 R190 T217 S218 G219
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0006259 DNA metabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gki, PDBe:5gki, PDBj:5gki
PDBsum5gki
PubMed27773688
UniProtQ5JER9|NUCS_THEKO Endonuclease NucS (Gene Name=nucS)

[Back to BioLiP]