Structure of PDB 5gji Chain A Binding Site BS01

Receptor Information
>5gji Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLR
KGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVK
LLYPVSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gji Crystal Structures and Thermodynamic Analysis Reveal Distinct Mechanisms of CD28 Phosphopeptide Binding to the Src Homology 2 (SH2) Domains of Three Adaptor Proteins
Resolution0.9 Å
Binding residue
(original residue number in PDB)
R340 R358 A360 S361 T369 L380 F392 S393 D394 Y416 N417 L420
Binding residue
(residue number reindexed from 1)
R17 R35 A37 S38 T46 L57 F69 S70 D71 Y93 N94 L97
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5gji, PDBe:5gji, PDBj:5gji
PDBsum5gji
PubMed27927989
UniProtP27986|P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha (Gene Name=PIK3R1)

[Back to BioLiP]