Structure of PDB 5gid Chain A Binding Site BS01

Receptor Information

>5gid Chain A (length=237) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMPLSMLPHLADLVSY
SIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSW
DCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAI
CIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQK
LADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFG

Ligand information

>5gid Chain C (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NHPMLMNLL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gid Regulation of the vitamin D receptor by vitamin D lactam derivatives.
Resolution	2.151 Å
Binding residue (original residue number in PDB)	I238 K242 I256 K260 P412 E416
Binding residue (residue number reindexed from 1)	I56 K60 I74 K78 P230 E234

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5gid, PDBe:5gid, PDBj:5gid
PDBsum	5gid
PubMed	27500498
UniProt	P13053\|VDR_RAT Vitamin D3 receptor (Gene Name=Vdr)

[Back to BioLiP]