Structure of PDB 5gh9 Chain A Binding Site BS01

Receptor Information
>5gh9 Chain A (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPM
DLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAE
VFEQEIDPVMQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gh9 Structural insight into CBP bromodomain-mediated recognition of acetylated histone H3K56ac
Resolution1.451 Å
Binding residue
(original residue number in PDB)		V1115 L1120 I1122 P1123 D1124 I1128 L1166 Y1167 N1168
Binding residue
(residue number reindexed from 1)		V32 L37 I39 P40 D41 I45 L83 Y84 N85
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5gh9, PDBe:5gh9, PDBj:5gh9
PDBsum5gh9
PubMed28815970
UniProtQ92793|CBP_HUMAN CREB-binding protein (Gene Name=CREBBP)

[Back to BioLiP]