Structure of PDB 5ggp Chain A Binding Site BS01

Receptor Information
>5ggp Chain A (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLDVEVYSSRSKVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKR
VFDTYSPHEDEAMVLFLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLG
SQAGPALGWRDTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLLKTDVPLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ggp Carbohydrate-binding domain of the POMGnT1 stem region modulates O-mannosylation sites of alpha-dystroglycan
Resolution1.599 Å
Binding residue
(original residue number in PDB)
Y152 F183 W206
Binding residue
(residue number reindexed from 1)
Y55 F86 W109
Enzymatic activity
Enzyme Commision number 2.4.1.-
External links
PDB RCSB:5ggp, PDBe:5ggp, PDBj:5ggp
PDBsum5ggp
PubMed27493216
UniProtQ8WZA1|PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 (Gene Name=POMGNT1)

[Back to BioLiP]