Structure of PDB 5gat Chain A Binding Site BS01

Receptor Information
>5gat Chain A (length=66) Species: 162425 (Aspergillus nidulans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKNGEQNGPTTCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLS
LKTDVIKKRNRNSANS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gat The solution structure of a fungal AREA protein-DNA complex: an alternative binding mode for the basic carboxyl tail of GATA factors.
ResolutionN/A
Binding residue
(original residue number in PDB)		P21 N34 A35 L38 F39 R61
Binding residue
(residue number reindexed from 1)		P21 N34 A35 L38 F39 R61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5gat, PDBe:5gat, PDBj:5gat
PDBsum5gat
PubMed9533883
UniProtP17429|AREA_EMENI Nitrogen regulatory protein areA (Gene Name=areA)

[Back to BioLiP]