Structure of PDB 5fvk Chain A Binding Site BS01

Receptor Information
>5fvk Chain A (length=82) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNP
KSKDLIRAKFTEYLNRAEQLKKHLESEEANAA
Ligand information
>5fvk Chain C (length=21) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NYSNTDPEELLRKHVFPSVPK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fvk Structural Fine-Tuning of Mit Interacting Motif 2 (Mim2) and Allosteric Regulation of Escrt-III by Vps4 in Yeast.
Resolution1.658 Å
Binding residue
(original residue number in PDB)		T3 L7 I18 D21 Y46 E47 K48 N49 K51 S52 K59 Y63 R66
Binding residue
(residue number reindexed from 1)		T3 L7 I18 D21 Y46 E47 K48 N49 K51 S52 K59 Y63 R66
Enzymatic activity
Enzyme Commision number 3.6.4.6: vesicle-fusing ATPase.
External links
PDB RCSB:5fvk, PDBe:5fvk, PDBj:5fvk
PDBsum5fvk
PubMed27075672
UniProtP52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 (Gene Name=VPS4)

[Back to BioLiP]