Structure of PDB 5fte Chain A Binding Site BS01

Receptor Information

>5fte Chain A (length=429) Species: 457390 (Bacteroides sp. 3_1_23)

DMILTEEMQKIMNLIQDDENNVFVTGKAGSGKTTFLKYLIEKSGKNCIVA
APTGIAAINAGGVTLHSLFGIPFGPITPYDRLENKFSEYKVELLLKMELL
IIDEISMVRPDILDTIDRKLRWVYESDEPFGGVQVIMFGDLFQLPPVTKK
QEREILSDFYDGFFFFNALVFKRTGFHIVELTKIFRQTEPEFINVLNNIR
NYQVTSDELDLLSELKDRKISSSYDNEYIHICTHKADVEKINADKLGEQE
IRNYDIVIKDKFPESSIPCDLHLKLRVGARVMSLVNDSLKGYYNGMLGIV
TALEDNVITVRMDNGRTIKFERYTWSNTQYTLKDNEIVKEEIGSCTQFPL
TLAWAITIHKSQGLTFDKIIIHVSHTFCPGQLYVALSRCRTLEGIVSDAF
ITKQMIIPEYALIDFERAYKSEGNYYGKR

Ligand information

>5fte Chain D (length=6)

tttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5fte Crystal Structures of the Bspif1 Helicase Reveal that a Major Movement of the 2B SH3 Domain is Required for DNA Unwinding
• Resolution: 3.19 Å
• Binding residue (original residue number in PDB): P54 T55 T66 H68 S69 G72 I73 P74 F75 N86 V149 K151 H236 K237 T359 H361 K362 C380 K430 R431
• Binding residue (residue number reindexed from 1): P52 T53 T64 H66 S67 G70 I71 P72 F73 N84 V147 K149 H234 K235 T357 H359 K360 C378 K428 R429

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 06:06:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5fte', asym_id = 'A', bs = 'BS01', title = 'Crystal Structures of the Bspif1 Helicase Reveal...f the 2B SH3 Domain is Required for DNA Unwinding'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5fte', asym_id='A', bs='BS01', title='Crystal Structures of the Bspif1 Helicase Reveal...f the 2B SH3 Domain is Required for DNA Unwinding')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0000723,0003678,0006281', uniprot = '', pdbid = '5fte', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000723,0003678,0006281', uniprot='', pdbid='5fte', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>