Structure of PDB 5fpx Chain A Binding Site BS01

Receptor Information
>5fpx Chain A (length=106) Species: 393305 (Yersinia enterocolitica subsp. enterocolitica 8081) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASKMFFINDETPWEELGNGIKRKVMTWSDDLMMVCVHFDKGAIGVAHKH
DIHDQIAYVAAGSFEVEIEGQKRILKAGDAYRAVKNEMHGAVSLEDNSIL
IDTFNP
Ligand information
>5fpx Chain E (length=7) Species: 393305 (Yersinia enterocolitica subsp. enterocolitica 8081) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSSHHHH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fpx Kdgf, the Missing Link in the Microbial Metabolism of Uronate Sugars from Pectin and Alginate.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		L15 R21 G43 V44 H46 H48 Q53 Y79 H87 L98 D100
Binding residue
(residue number reindexed from 1)		L17 R23 G45 V46 H48 H50 Q55 Y81 H89 L100 D102
Enzymatic activity
Enzyme Commision number ?
External links