Structure of PDB 5fox Chain A Binding Site BS01

Receptor Information
>5fox Chain A (length=222) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQL
PPEEGGLNGSVMWIDTENTFRPERIREIAQNRGLDPDEVLKHIAYARAFN
SNHQMLLVQQAEDMIKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAER
QQKLAKHLADLHRLANLYDIAVFVTNQVLAHSATLRVYLRKGKGGKRIAR
LIDAPLPEGEAVFSITEKGIED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fox Structure Activity Relationship of the Peptide Binding Motif Mediating the Rad51:Brca2 Protein-Protein Interaction.
Resolution1.3 Å
Binding residue
(original residue number in PDB)		M169 F177 L197 I200 A201 Y202 A203 L214 A218
Binding residue
(residue number reindexed from 1)		M62 F70 L90 I93 A94 Y95 A96 L107 A111
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5fox, PDBe:5fox, PDBj:5fox
PDBsum5fox
PubMed26992456
UniProtO74036|RADA_PYRFU DNA repair and recombination protein RadA (Gene Name=radA)

[Back to BioLiP]