Structure of PDB 5fj4 Chain A Binding Site BS01

Receptor Information
>5fj4 Chain A (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
Ligand information
>5fj4 Chain D (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagggagcgccauugcacuccggugcgaagaacuc
<<<...<<<<<..........>>>>>......>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fj4 A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K20 L49 K50 M51 R52 Q54 F56 Q85 A87 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 K15 L44 K45 M46 R47 Q49 F51 Q80 A82 K83 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5fj4, PDBe:5fj4, PDBj:5fj4
PDBsum5fj4
PubMed27016741
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]