Structure of PDB 5fhe Chain A Binding Site BS01

Receptor Information
>5fhe Chain A (length=426) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DMILTEEMQKIMNLIQENNVFVTGKAGSGKTTFLKYLIEKSGKNCIVAAP
TGIAAINAGGVTLHSLFGIPFGPITPYDRLENKFSEYKVELLLKMELLII
DEISMVRPDILDTIDRKLRWVYESDEPFGGVQVVMFGDLFQLPPVTKKQE
REILSDFYDGFFFFNALVFKRTGFHIVELTKIFRQTEPEFINVLNNIRNY
QVTSDELDLLSELKDRKISSSNEYIHICTHKADVEKINADKLGEQEIRNY
DIVIKDKFPESSIPCDLHLKLRVGARVMSLVNDSLKGYYNGMLGIVTALE
DNVITVRMDNGRTIKFERYTWSNTQYTLKDNEIVKEEIGSCTQFPLTLAW
AITIHKSQGLTFDKIIIHVSHTFCPGQLYVALSRCRTLEGIVSDAFITKQ
MIIPEYALIDFERAYKSEGNYYGKRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fhe Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1
Resolution2.9 Å
Binding residue
(original residue number in PDB)		P54 T55 T66 H68 S69 G72 I73 P74 F75 N86 V149 H236 K237 T359 H361 K362 F379
Binding residue
(residue number reindexed from 1)		P50 T51 T62 H64 S65 G68 I69 P70 F71 N82 V145 H230 K231 T353 H355 K356 F373
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 23:39:07 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5fhe', asym_id = 'A', bs = 'BS01', title = 'Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5fhe', asym_id='A', bs='BS01', title='Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000723,0003678,0006281', uniprot = '', pdbid = '5fhe', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000723,0003678,0006281', uniprot='', pdbid='5fhe', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>