Structure of PDB 5fg8 Chain A Binding Site BS01

Receptor Information
>5fg8 Chain A (length=269) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQ
KLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVARE
FYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLA
DFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI
LLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVN
PNKRITAAEALKHPWICQR
Ligand information
>5fg8 Chain B (length=15) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ATLARQDTIDEGGEV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fg8 The Interaction between the Drosophila EAG Potassium Channel and the Protein Kinase CaMKII Involves an Extensive Interface at the Active Site of the Kinase.
Resolution1.955 Å
Binding residue
(original residue number in PDB)
R53 K57 E97 F99 D136 K138 E140 W171 F172 G173 F174 A175 G176 T177 G179 P212 W215
Binding residue
(residue number reindexed from 1)
R47 K51 E91 F93 D130 K132 E134 W165 F166 G167 F168 A169 G170 T171 G173 P206 W209
Enzymatic activity
Catalytic site (original residue number in PDB) D136 K138 N141 D157 T177
Catalytic site (residue number reindexed from 1) D130 K132 N135 D151 T171
Enzyme Commision number 2.7.11.17: calcium/calmodulin-dependent protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5fg8, PDBe:5fg8, PDBj:5fg8
PDBsum5fg8
PubMed30381148
UniProtQ00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain (Gene Name=CaMKII)

[Back to BioLiP]