Structure of PDB 5ffw Chain A Binding Site BS01

Receptor Information
>5ffw Chain A (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMK
QNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVL
RQARRQAEKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ffw Crystal structure of the bromodomain of human BRPF1 in complex with H4K5acK8ac histone peptide
Resolution1.5 Å
Binding residue
(original residue number in PDB)
V657 D664 H668 Y707 N708 I713 F714
Binding residue
(residue number reindexed from 1)
V28 D35 H39 Y78 N79 I84 F85
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ffw, PDBe:5ffw, PDBj:5ffw
PDBsum5ffw
PubMed
UniProtP55201|BRPF1_HUMAN Peregrin (Gene Name=BRPF1)

[Back to BioLiP]