Structure of PDB 5fd3 Chain A Binding Site BS01

Receptor Information
>5fd3 Chain A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKAC
LDRNPEAFKPKKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEES
PERKTLMH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fd3 Structural basis for LIN54 recognition of CHR elements in cell cycle-regulated promoters.
Resolution2.42 Å
Binding residue
(original residue number in PDB)		K534 L535 Y536 R574 C599 N600 C601 K602 R603 S604 Y610 E612
Binding residue
(residue number reindexed from 1)		K13 L14 Y15 R53 C64 N65 C66 K67 R68 S69 Y75 E77
Binding affinityPDBbind-CN: Kd=2.8uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5fd3, PDBe:5fd3, PDBj:5fd3
PDBsum5fd3
PubMed27465258
UniProtQ6MZP7|LIN54_HUMAN Protein lin-54 homolog (Gene Name=LIN54)

[Back to BioLiP]