Structure of PDB 5f8t Chain A Binding Site BS01

Receptor Information
>5f8t Chain A (length=239) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLP
LQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQ
APLNYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNI
PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMW
RLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f8t The crystal structure of human Plasma Kallikrein in complex with its peptide inhibitor pkalin-2
Resolution1.75 Å
Binding residue
(original residue number in PDB)		R39 H57 D60 V96 E98 Y174 K192 G193 S195 S214 W215 G216 E217
Binding residue
(residue number reindexed from 1)		R26 H44 D47 V87 E89 Y165 K185 G186 S188 S207 W208 G209 E210
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 K192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H44 D93 K185 G186 D187 S188 G189
Enzyme Commision number 3.4.21.34: plasma kallikrein.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5f8t, PDBe:5f8t, PDBj:5f8t
PDBsum5f8t
PubMed
UniProtP03952|KLKB1_HUMAN Plasma kallikrein (Gene Name=KLKB1)

[Back to BioLiP]