Structure of PDB 5f5j Chain A Binding Site BS01

Receptor Information
>5f5j Chain A (length=181) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTH
ALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQK
FSGPWFGGLSGVVFALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGW
FDLFGMSMANGAHIAGLAVGLAMAFVDSLNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f5j Crystal Structures and Inhibition Kinetics Reveal a Two-Stage Catalytic Mechanism with Drug Design Implications for Rhomboid Proteolysis.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		M120 F146 H150 S193 W196 F197 G198 G199 S201 S248 M249 A250
Binding residue
(residue number reindexed from 1)		M29 F55 H59 S102 W105 F106 G107 G108 S110 S157 M158 A159
Enzymatic activity
Enzyme Commision number 3.4.21.105: rhomboid protease.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5f5j, PDBe:5f5j, PDBj:5f5j
PDBsum5f5j
PubMed26805573
UniProtP09391|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]