Structure of PDB 5f5g Chain A Binding Site BS01

Receptor Information

>5f5g Chain A (length=181) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTH
ALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQK
FSGPWFGGLSGVVFALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGW
FDLFGMSMANGAHIAGLAVGLAMAFVDSLNA

Ligand information

>5f5g Chain B (length=3) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RMA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5f5g Crystal Structures and Inhibition Kinetics Reveal a Two-Stage Catalytic Mechanism with Drug Design Implications for Rhomboid Proteolysis.
Resolution	2.3 Å
Binding residue (original residue number in PDB)	H150 S193 W196 F197 G198 G199 S201 S248 M249 A250
Binding residue (residue number reindexed from 1)	H59 S102 W105 F106 G107 G108 S110 S157 M158 A159

Enzymatic activity

Enzyme Commision number

3.4.21.105: rhomboid protease.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5f5g, PDBe:5f5g, PDBj:5f5g
PDBsum	5f5g
PubMed	26805573
UniProt	P09391\|GLPG_ECOLI Rhomboid protease GlpG (Gene Name=glpG)

[Back to BioLiP]