Structure of PDB 5f1n Chain A Binding Site BS01

Receptor Information
>5f1n Chain A (length=275) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFYTSVSRPGRGDPRFIAVGYVDDTQFVRFDSDAATGRTEPRAP
WVEQEGPEYWDGETRKVKETAQVYRVDLDTLRGYYNQSEAGSHTIQTMYG
CDLGPGGRLLRGYRQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAA
GVAELQWRNYLETTCVEWLQRYLEMGKETLLRAEPPSTRVTRHPISDHEV
TLRCWALGFYPAEITLTWQRDGEDQTQDTEVVDTRPAGDGTFQKWAAVVV
PSGQEQRYTCHVQHEGLVEPVTRRW
Ligand information
>5f1n Chain C (length=11) Species: 9615 (Canis lupus familiaris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RFLDKDGFIDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5f1n Diversified Anchoring Features the Peptide Presentation of DLA-88*50801: First Structural Insight into Domestic Dog MHC Class I
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y7 Y9 E58 Y59 E63 K66 V67 T70 V73 D77 Y84 Y99 R114 D116 T143 K146 W147 V152 Q156 W157 Y160 W168 Y172
Binding residue
(residue number reindexed from 1)		Y7 Y9 E58 Y59 E63 K66 V67 T70 V73 D77 Y84 Y99 R114 D116 T143 K146 W147 V152 Q156 W157 Y160 W168 Y172
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
Cellular Component
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5f1n, PDBe:5f1n, PDBj:5f1n
PDBsum5f1n
PubMed27511732
UniProtJ9UGS3

[Back to BioLiP]